PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30678-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 379aa    MW: 41028.9 Da    PI: 9.2392
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30678-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.76.9e-35130186561
           zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       l+cprC+stntkfCy+nnysl+qPr+fC++C ryWt+GG lrnvPvGgg r++ k+
  TRIUR3_30678-P1 130 GLNCPRCESTNTKFCYFNNYSLTQPRHFCRSCSRYWTRGGVLRNVPVGGGYRRHAKR 186
                      579***********************************************9998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-33111185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.959131185IPR003851Zinc finger, Dof-type
PfamPF027013.8E-30131185IPR003851Zinc finger, Dof-type
PROSITE patternPS013610133169IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MAIMEINRPR GGALLKRRRL GSPAMIFLPA FLDSSDFWNT DHNQLQLQQI GTSTHSTTTS  60
SPNGPGDGGC NNNNPKGFMA TTGADYGVAG GGDDGCGGAG DGDCSRGRNN KSISMSERAR  120
LARLPHPVPG LNCPRCESTN TKFCYFNNYS LTQPRHFCRS CSRYWTRGGV LRNVPVGGGY  180
RRHAKRRAKP KVVSATSRAS TVGKSSMTPT MSSSTTYATG TDISPPRLQY PIFGSTPSHD  240
SQFSDIFDPA NLGLGFPVRL LFAESDAYTV DGCAHHHHHH AHGNGMEQLL EAQNSFPFMH  300
AMDHHMSGLP AEAMPITMAT MQGMFHLGLQ SVRGGHGDEI AGQQLHYPLA KRNHKHQDYA  360
SSRGMHRDVV NGNGTGGYI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11519KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8AIU40.0M8AIU4_TRIUA; Dof zinc finger protein DOF3.6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.22e-38OBF-binding protein 3